Joined in 2023 
82 
63 About this deal
Rats with reproductive dysfunction induced by cyclophosphamide exhibited Increase the level of key regulatory protein expression and androgen in the blood Repress inflammatory cytokines and mediators (TNF-α, IL-1β, IL-6, iNOS) at transcription level in LPS-induced RAW264.7 cells By being mindful of these considerations and following these tips, you can make informed choices when consuming canned oysters and minimize any potential risks. Incorporating Canned Oysters Into a Balanced Diet
Another consideration when consuming canned oysters is the possibility of allergies or sensitivities. Some individuals may be allergic to shellfish, including oysters, and can experience adverse reactions ranging from mild symptoms like itching or hives to severe allergic reactions that require immediate medical attention. It’s essential to be aware of any known allergies or sensitivities and to consult with a healthcare professional if there are any concerns.It was Giacomo Casanova who gave oysters its legendary reputation as an aphrodisiac. The Italian adventurer credited oysters with his libido and energy. And while we may take his exploits with a pinch of salt, his belief in oysters may have a hefty grain of truth. Research now tells us that oysters may indeed help boost sexual performance and libido, thanks to high zinc content. Zinc is also associated with sexual dysfunction in men, with impotence and erectile dysfunction believed to be caused due to zinc deficiency. It is also beneficial for embryonic development in women. [3] [4]
Growth and Development: Zinc supports proper growth, development, and cellular division, particularly during childhood and adolescence. Zinc plays many important roles in your overall health. It’s one of the things that your body needs for: Identified protein with osteogenic activity which are responsible for the bone remodelling and biocompatibility
People with Gastrointestinal and Other Diseases - Gastrointestinal surgery, Crohn's disease, ulcerative colitis, short bowel syndrome and other digestive diseases can all decrease zinc absorption and increase zinc loss from the body. Vegetarians - The bio-availability of zinc is higher in meats and thus more easily absorbed. Further, legumes and whole grains contain phytates which bind zinc and inhibit absorption. Vegetarians should aim to eat 50% DV more zinc each day to ensure proper levels. For more vegetarian sources of zinc see the lists of vegetarian zinc foods, high zinc fruits and high zinc vegetables.
Oysters contain the most zinc in any food — 10 times higher than the next richest source, red meat!* Remember, zinc plays a crucial role in maintaining a healthy body and supporting various physiological functions. By including zinc-rich foods in your diet and meeting the recommended daily intake, you can support your overall well-being and optimize your health. Zinc Content in Canned Oysters Image taken by: wp.com On the other hand, zinc deficiency can do a number on immune system function, causing increased susceptibility to various pathogens and a host of health issues. Researchers have discovered that improving zinc levels through diet and supplementation may ease inflammation.* Zinc is also instrumental in the process of wound healing. It supports tissue growth and repair, making it crucial for the formation of new skin cells and the closure of wounds. Zinc helps regulate inflammatory responses, which is vital during the initial stages of wound healing. Furthermore, it plays a role in collagen synthesis, a protein essential for the structure and integrity of skin, tendons, and blood vessels. By including zinc-rich foods in your diet, you can facilitate the healing process and ensure optimal recovery from injuries. Enhancing Cognitive Function QAQALLPIASYAGLTVSAPVFAALVTVYGAYALYRYNIRRRENSYQRIRSDHDSHSCANNRGWCRPTCFSHEYTDWFNNDVCGSYRCCRPGRSG (10.7kDa)
Search our site for
Zinc is in many foods that are part of a common diet, especially meat and seafood, and also whole grains, beans, and nuts. Here are some food sources of zinc: Chaturvedi et al. (2013) showed that water-soluble bioactive compounds in nacre possess antioxidant activity and promote osteoblast differentiation. A study on the osteogenic potency of human mesenchymal stem cells indicated that nacre and its soluble protein matrix induce early differentiation of human bone cells via osteoinductive effects ( Green et al., 2015). Studies have also been conducted on nacre powder mixed with blood, nacre chips, nacre prostheses, and nacre matrix proteins, as well as the effects of nacre WSM on alkaline phosphate activity in MRC-5 fibroblasts and osteogenic activities of nacre WSM and ESM (for a review, see Zhang et al., 2017). Recent in vitro and in vivo studies demonstrated anti-osteoporosis effects of WSMPs from C. gigas that result from the promotion of osteogenesis and inhibition of osteoclast absorption ( Feng et al., 2021). Shell extracts also activate the catabolic pathway of human dermal fibroblasts and are thus used in anti-fibrotic strategies, especially in the scleroderma. Latire et al. (2017) and Khoi et al. (2015) investigated the ability of oyster shell extract to inhibit lipogenesis and thus provide a lipid-lowering effect (especially of cellular triglycerides). These studies suggest that oyster shell extracts such as those from the WSM and ESM and WSMPs have a wide range of therapeutic and medicinal effects, including anti-osteoporotic, anti-fibrotic, and osteogenic activities as well as lipogenesis inhibition. Thus, they can play a role in human tissue engineering. Environmental and Other Apllications of Shell Waste/Byproducts Phillips KE, Satchell KJ. Vibrio vulnificus: From oyster colonist to human pathogen. PLoS Pathog. 2017;13(1):e1006053. doi:10.1371/journal.ppat.1006053 Reference Dietary Intake (%RDI) -The reference dietary intake is similar to the recommended daily allowance, but is specific to age and gender. The RDI for amino acids is set by the U.N. World Health Organization. Osteoclastogenesis by inactivating the NF-κB-mediated NFATc1 and c-Fos signaling pathways and scavenging the ROS generation in RAW 264.7 Cells
Antioxidant Defense: Zinc acts as an antioxidant, protecting cells from oxidative damage and reducing inflammation. But eating an oyster or taking an oyster zinc supplement is different than popping a synthetic zinc tablet. Incorporating these and other zinc-rich foods into your diet can help ensure you meet your daily zinc requirements and enjoy the associated health benefits. However, it’s essential to note that excessive zinc intake can have adverse effects, so it’s recommended to obtain zinc through a balanced diet rather than relying solely on supplements. Potential Risks or Considerations Turner RB, Cetnarowski WE. Effect of treatment with zinc gluconate or zinc acetate on experimental and natural colds. Clin Infect Dis 2000;31:1202-8.Reduced Severity and Duration of Diarrhea - Studies show that increased intake of zinc can reduce duration and severity of diarrhea in undernourished children with infections.(14-17) One serving also provides 176 calories, 20 grams of protein, and 10 grams of fat. Plus, it’s a great source of many other essential nutrients, like iron, B vitamins, and creatine ( 4). Pregnant and Lactating Women - A developing fetus requires a high amount of zinc, likewise, there is a high amount of zinc lost through breast milk after birth.
Great Deal 
New Comment